SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_039140.1.37955 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_039140.1.37955
Domain Number - Region: 14-44
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 0.0575
Family tRNA-intron endonuclease catalytic domain-like 0.013
Further Details:      
 
Domain Number - Region: 35-66
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_039140.1.37955
Sequence length 68
Comment hypothetical protein FPV177 [Fowlpox virus]; AA=GCF_000838605.1; RF=na; TAX=10261; STAX=10261; NAME=Fowlpox virus; AL=Complete Genome; RT=Major
Sequence
MSIIIIIFFVLICYFALFFYTSSGVIFGPDYKRYKDGDIIADRINEEKVKIKKIAKNIDV
VNRELLKY
Download sequence
Identical sequences Q70GY3 Q9J556
Q70GY3_FOWPV Q9J556_FOWPV NP_039140.1.37955 gi|9634847|ref|NP_039140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]