SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_044110.1.95897 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_044110.1.95897
Domain Number 1 Region: 94-177
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000224
Family DEATH effector domain, DED 0.025
Further Details:      
 
Domain Number 2 Region: 13-74
Classification Level Classification E-value
Superfamily DEATH domain 0.0000106
Family DEATH effector domain, DED 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_044110.1.95897
Sequence length 241
Comment MC159L [Molluscum contagiosum virus subtype 1]; AA=GCF_000843325.1; RF=na; TAX=10280; STAX=10279; NAME=Molluscum contagiosum virus subtype 1; AL=Complete Genome; RT=Major
Sequence
MSDSKEVPSLPFLRHLLEELDSHEDSLLLFLCHDAAPGCTTVTQALCSLSQQRKLTLAAL
VEMLYVLQRMDLLKSRFGLSKEGAEQLLGTSFLTRYRKLMVCVGEELDSSELRALRLFAC
NLNPSLSTALSESSRFVELVLALENVGLVSPSSVSVLADMLRTLRRLDLCQQLVEYEQQE
QARYRYCYAASPSLPVRTLRRGHGASEHEQLCMPVQESSDSPELLRTPVQESSSDSPEQT
T
Download sequence
Identical sequences A0A1S7DNI9 Q98325
NP_044110.1.95897 gi|9629091|ref|NP_044110.1| CFLA_MCV1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]