SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_046298.1.14604 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_046298.1.14604
Domain Number 1 Region: 25-87
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000196
Family Tachycitin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_046298.1.14604
Sequence length 95
Comment hypothetical protein OpmnVgp142 [Orgyia pseudotsugata multiple nucleopolyhedrovirus]; AA=GCF_000837125.1; RF=na; TAX=262177; STAX=262177; NAME=Orgyia pseudotsugata multiple nucleopolyhedrovirus; AL=Complete Genome; RT=Major
Sequence
MILLVLFLVLLKVLIFKRLNEMHLDSHHNQICPRGYFGLNADPFDCNAYYMCPHKVRMFC
DPGHEFELDSATCVPIEYDCLGSGCTARLYRNLLL
Download sequence
Identical sequences O10373
gi|9630080|ref|NP_046298.1| NP_046298.1.14604 Y145_NPVOP

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]