SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_056789.1.14623 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_056789.1.14623
Domain Number 1 Region: 206-333
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 8.63e-53
Family Retrovirus capsid protein, N-terminal core domain 0.00000414
Further Details:      
 
Domain Number 2 Region: 1-97
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 1.94e-42
Family MMLV matrix protein-like 0.0000107
Further Details:      
 
Domain Number 3 Region: 471-513
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000359
Family Retrovirus zinc finger-like domains 0.00095
Further Details:      
 
Weak hits

Sequence:  NP_056789.1.14623
Domain Number - Region: 343-369
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00531
Family Retrovirus capsid protein C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_056789.1.14623
Sequence length 520
Comment Gag polyprotein [Gibbon ape leukemia virus]; AA=GCF_000849965.1; RF=na; TAX=11840; STAX=11840; NAME=Gibbon ape leukemia virus; AL=Complete Genome; RT=Major
Sequence
MGQDNSTPISLTLNHWRDVRTRAHNLSVEIKKGKWQTFCSSEWPTFGVGWPPEGTFNLSV
IFAVKKIVFQENGGHPDQVPYIVVWQDLAQNPPPWVPASAKVAVVSDTRRPVAGRPSAPP
RPPIYPATDDLLLLSEPTPPPYPAALPPPLAPQAIGPPSGQMPDSSDPEGPAAGTRSRRA
RSPADNSGPDSTVILPLRAIGPPAEPNGLVPLQYWPFSSADLYNWKSNHPSFSENPAGLT
GLLESLMFSHQPTWDDCQQLLQILFTTEERERILLEARKNVLGDNGAPTQLENLINEAFP
LNRPHWDYNTAAGRERLLVYRRTLVAGLKGAARRPTNLAKVREVLQGPAEPPSVFLERLM
EAYRRYTPFDPSSEGQQAAVAMAFIGQSAPDIKKKLQRLEGLQDYSLQDLVKEAEKVYHK
RETEEERQEREKKEAEEKERRRDRPKKKNLTKILAAVVSREGSTGRQTGNLSNQAKKTPR
DGRPPLDKDQCAYCKEKGHWARECPRKKHVREAKVLALDN
Download sequence
Identical sequences P21416
NP_056789.1.14623 GAG_GALV gi|9630312|ref|NP_056789.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]