SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_057642.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_057642.1.87134
Domain Number 1 Region: 102-166
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.66e-25
Family SCAN domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_057642.1.87134
Sequence length 179
Comment SCAN domain-containing protein 1 isoform 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MAATEPILAATGSPAAVPPEKLEGAGSSSAPERNCVGSSLPEASPPAPEPSSPNAAVPEA
IPTPRAAASAALELPLGPAPVSVAPQAEAEARSTPGPAGSRLGPETFRQRFRQFRYQDAA
GPREAFRQLRELSRQWLRPDIRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDVRITG
Download sequence
Identical sequences A1YEW3 P57086
ENSGGOP00000001652 ENSGGOP00000001652 gi|7706089|ref|NP_057642.1| ENSP00000301995 ENSP00000363103 ENSP00000301995 ENSP00000363103 ENSP00000481289 9606.ENSP00000301995 ENSP00000301995 NP_057642.1.87134 NP_057642.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]