SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_058713.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_058713.1.100692
Domain Number 1 Region: 486-723
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.19e-58
Family Eukaryotic proteases 0.000000011
Further Details:      
 
Domain Number 2 Region: 116-214
Classification Level Classification E-value
Superfamily Kringle-like 2.13e-35
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 3 Region: 211-294
Classification Level Classification E-value
Superfamily Kringle-like 7.73e-34
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 4 Region: 303-386
Classification Level Classification E-value
Superfamily Kringle-like 9.67e-32
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 5 Region: 382-478
Classification Level Classification E-value
Superfamily Kringle-like 1.79e-28
Family Kringle modules 0.00041
Further Details:      
 
Domain Number 6 Region: 37-126
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.71e-22
Family Hairpin loop containing domain 0.00000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_058713.1.100692
Sequence length 728
Comment hepatocyte growth factor preproprotein [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MMWGTKLLPVLLLQHVLLHLLLLPVTIPYAEGQKKRRNTLHEFKKSAKTTLTKEDPLVKI
KTKKVNSADECANRCIRNKGFPFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLY
ENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRN
PRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQT
PHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSAVNETDVP
METTECIKGQGEGYRGTTNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDG
AESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNM
EDLHRHIFWEPDASKLTKNYCRNPDDDAHGPWCYTGNPLVPWDYCPISRCEGDTTPTIVN
LDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPAR
NKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTI
DLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESEL
CAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIH
KVILTYKL
Download sequence
Identical sequences P17945
NP_058713.1.100692 NP_058713.1.4139 ENSRNOP00000009764 10116.ENSRNOP00000009764 ENSRNOP00000009764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]