SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_061121.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_061121.2.87134
Domain Number 1 Region: 46-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.92e-38
Family SCAN domain 0.0000629
Further Details:      
 
Domain Number 2 Region: 643-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.34e-27
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 587-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 531-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.04e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 5 Region: 475-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.2e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 419-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 685-737
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 8 Region: 381-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 224-284
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000458
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_061121.2.87134
Sequence length 754
Comment zinc finger protein with KRAB and SCAN domains 7 isoform 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MTTAGRGNLGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPE
SGEEAVAVVEDFQRHLSGSEEVSAPAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAH
LEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAGATVLRMVRPQDTVAYEDLSVDY
TQKKWKSLTLSQRALQWNMMPENHHSMASLAGENMMKGSELTPKQEFFKGSESSNRTSGG
LFGVVPGAAETGDVCEDTFKELEGQTSDEEGSRLENDFLEITDEDKKKSTKDRYDKYKEV
GEHPPLSSSPVEHEGVLKGQKSYRCDECGKAFNRSSHLIGHQRIHTGEKPYECNECGKTF
RQTSQLIVHLRTHTGEKPYECSECGKAYRHSSHLIQHQRLHNGEKPYKCNECAKAFTQSS
RLTDHQRTHTGEKPYECNECGEAFIRSKSLARHQVLHTGKKPYKCNECGRAFCSNRNLID
HQRIHTGEKPYECSECGKAFSRSKCLIRHQSLHTGEKPYKCSECGKAFNQNSQLIEHERI
HTGEKPFECSECGKAFGLSKCLIRHQRLHTGEKPYKCNECGKSFNQNSHLIIHQRIHTGE
KPYECNECGKVFSYSSSLMVHQRTHTGEKPYKCNDCGKAFSDSSQLIVHQRVHTGEKPYE
CSECGKAFSQRSTFNHHQRTHTGEKSSGLAWSVS
Download sequence
Identical sequences Q9P0L1
9606.ENSP00000273320 gi|47716687|ref|NP_061121.2| ENSP00000273320 ENSP00000395524 NP_001275519.1.87134 NP_001275519.1.92137 NP_061121.2.87134 NP_061121.2.92137 ENSP00000345404 ENSP00000273320 ENSP00000395524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]