SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_067546.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_067546.1.92137
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily DEATH domain 5.65e-27
Family Caspase recruitment domain, CARD 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_067546.1.92137
Sequence length 90
Comment caspase recruitment domain-containing protein 18 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDL
VTGKGPKSCCKFIKHLCEEDPQLASKMGLH
Download sequence
Identical sequences P57730
ENSP00000436691 ENSP00000436691 NP_067546.1.87134 NP_067546.1.92137 gi|10954343|ref|NP_067546.1| ENSP00000436691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]