SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_071796.2.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_071796.2.100692
Domain Number 1 Region: 4024-4262
Classification Level Classification E-value
Superfamily Plakin repeat 1.22e-87
Family Plakin repeat 0.0000000215
Further Details:      
 
Domain Number 2 Region: 3445-3684
Classification Level Classification E-value
Superfamily Plakin repeat 3.53e-87
Family Plakin repeat 0.0000000521
Further Details:      
 
Domain Number 3 Region: 180-402
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.81e-86
Family Calponin-homology domain, CH-domain 0.000000605
Further Details:      
 
Domain Number 4 Region: 2785-3026
Classification Level Classification E-value
Superfamily Plakin repeat 3.4e-86
Family Plakin repeat 0.0000000799
Further Details:      
 
Domain Number 5 Region: 3114-3353
Classification Level Classification E-value
Superfamily Plakin repeat 9.55e-79
Family Plakin repeat 0.000000315
Further Details:      
 
Domain Number 6 Region: 3782-4019
Classification Level Classification E-value
Superfamily Plakin repeat 7.59e-77
Family Plakin repeat 0.000000914
Further Details:      
 
Domain Number 7 Region: 4335-4376,4411-4605
Classification Level Classification E-value
Superfamily Plakin repeat 1.31e-70
Family Plakin repeat 0.000000286
Further Details:      
 
Domain Number 8 Region: 418-534
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-23
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 9 Region: 1292-1477
Classification Level Classification E-value
Superfamily Spectrin repeat 3.1e-20
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 10 Region: 758-860
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-17
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 11 Region: 4282-4330
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000235
Family Plakin repeat 0.0093
Further Details:      
 
Domain Number 12 Region: 665-757
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000667
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 13 Region: 865-943
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000691
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_071796.2.100692
Sequence length 4687
Comment plectin isoform 1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MVAGMLMPLDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMTSLKARGL
VRETFAWCHFYWYLTNEGIDHLRQYLHLPPEIVPASLQRVRRPVAMVMPARRRSPHVQTM
QGPLGCPPKRGPLPAEDPAREERQVYRRKEREEGAPETPVVSATIVGTLARPGPEPTPAT
DERDRVQKKTFTKWVNKHLIKAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREKGRMRF
HKLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSED
MTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHRHKPMLIDMNKVYRQTNLE
NLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMPRVPGAQDGVRANEL
QLRWQEYRELVLLLLQWIRHHTAAFEERKFPSSFEEIEILWCQFLKFKETELPAKEADKN
RSKGIYQSLEGAVQAGQLKIPPGYHPLDVEKEWGKLHVAILEREKQLRSEFERLECLQRI
VSKLQMEAGLCEEQLNQADSLLQSDIRLLASGKAAQRAGEVERDLDKADGMIRLLFNDVQ
TLKDGRHPQGEQMYRRVYRLHERLVAIRTEYNLRLKAGVGAPVTQVTLQSTQRRPELEDS
TLRYLHDLLAWVEENQRRIDGAEWGVDLPSVEAQLGSHRGMHQSIEEFRAKIERARNDES
QLSPATRGAYRDCLGRLDLQYAKLLNSSKARLRSLESLHGFVAAATKELMWLNEKEEEEV
GFDWSDRNTNMAAKKESYSALMRELEMKEKKIKEIQNTGDRLLREDHPARPTVESFQAAL
QTQWSWMLQLCCCIEAHLKENTAYFQFFSDVREAEEQLQKLQETLRRKYSCDRSITVTRL
EDLLQDAQDEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLLAVCDYKQVEV
TVHKGDQCQLVGPAQPFHWKVLGGSSSEAAVPSVCFLVPPPNQEAQEAVARLEAQHQALV
TLWHQLHVDMKSLLAWQSLNRDIQLIRSWSLVTFRTLKPEEQRQALRNLELHYQAFLRDS
QDAGGFGPEDRLVAEREYGSCSRHYQQLLQSLEQGEQEESRCQRCISELKDIRLQLEACE
TRTVHRLRLPLDKDPARECAQRIAEQQKAQAEVEGLGKGVARLSAEAEKVLALPEPSPAA
PTLRSELELTLGKLEQVRSLSAIYLEKLKTISLVIRSTQGAEEVLKTHEEHLKEAQAVPA
TLQELEVTKASLKKLRAQAEAQQPVFNTLRDELRGAQEVGERLQQRHGERDVEVERWRER
VTQLLERWQAVLAQTDVRQRELEQLGRQLRYYRESADPLSSWLQDAKSRQEQIQAVPIAN
SQAAREQLRQEKALLEEIERHGEKVEECQKFAKQYINAIKDYELQLITYKAQLEPVASPA
KKPKVQSGSESVIQEYVDLRTRYSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERE
RLAEVEAALEKQRQLAEAHAQAKAQAELEARELQRRMQEEVTRREEAAVDAQQQKRSIQE
ELQHLRQSSEAEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEDELQALRA
RAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAEAEAAREKQRALQALDE
LKLQAEEAERRLRQAEAERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEH
VTVTQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQAEEVAQQKSLAQA
DAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRA
ETEQGEQQRQLLEEELARLQHEATAATQKRQELEAELAKVRAEMEVLLASKARAEEESRS
TSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDAARQRAEAERVLTEKLA
AISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAAQHKADIEERLAQLRK
ASESELERQKGLVEDTLRQRRQVEEEIMALKASFEKAAAGKAELELELGRIRSNAEDTMR
SKELAEQEAARQRQLAAEEEQRRREAEERVQRSLAAEEEAARQRKVALEEVERLKAKVEE
ARRLRERAEQESARQLQLAQEAAQKRLQAEEKAHAFVVQQREEELQQTLQQEQNMLERLR
SEAEAARRAAEEAEEAREQAEREAAQSRKQVEEAERLKQSAEEQAQAQAQAQAAAEKLRK
EAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDH
QKSILDEELQRLKAEVTEAARQRSQVEEELFSVRVQMEELGKLKARIEAENRALILRDKD
NTQRFLEEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQ
EATRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEAERQRQLEMSA
EAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQ
SDQDAERLREAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQILQETQALQKSFLSEKD
SLLQRERFIEQEKAKLEQLFQDEVAKAKQLQEEQQRQQQQMEQEKQELVASMEEARRRQR
EAEEGVRRKQEELQRLEQQRQQQEKLLAEENQRLRERLQRLEEEHRAALAHSEEIATSQA
AATKALPNGRDALDGPSMEAEPEYTFEGLRQKVPAQQLQEAGILSMEELQRLTQGHTTVA
ELTQREDVHRYLKGGSSIAGLLLKPTNEKLSVYTALQRQLLSPGTALILLEAQAASGFLL
DPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGEQISLFQAMKKDLIVRD
HGIRLLEAQIATGGIIDPVHSHRVPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHE
NLTYLQLLERCVEDPETGLRLLPLTDKAAKGGELVYTDTEARDVFEKATVSAPFGKFQGK
TVTIWEIINSEYFTAEQRRDLLRQFRTGRITVEKIIKIVITVVEEHERKGQLCFEGLRAL
VPAAELLDSGVISHEVYQQLQRGERSVREVAEADEVRQALRGTSVIAGVWLEEAGQKLSI
YEALRRDLLQPEVAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPEMHEKLLSAEK
AVTGYRDPYSGQSVSLFQALKKGLIPREQGLRLLDAQLSTGGIVDPSKSHRVPLDVAYAR
GYLDKETNRALTSPRDDARVYLDPSTREPVTYSQLQQRCRSDQLTGLSLLPLSEKAVRAR
QEEVYSELQARETLEKAKVEVPVGGFKGRALTVWELISSEYFTEEQRQELLRQFRTGKVT
VEKVIKILITIVEEVETQRQERLSFSGLRAPVPASELLASKILSRTQFEQLKDGKTSVKD
LSEVGSVRTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRPSTATLLLEAQAATGFLVD
PVRNQRLYVHEAVKAGVVGPELHEKLLSAEKAVTGYKDPYSGSTISLFQAMKKGLVLRDH
AIRLLEAQIATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHEN
LTYLQLLERCVEDPETGLRLLPLRGAEKTEVVETTQVYTEEETRRAFEETQIDIPGGGSH
GGSSMSLWEVMQSDMIPEDQRARLMADFQAGRVTKERMIIIIIEIIEKTEIIRQQNLASY
DYVRRRLTAEDLYEARIISLETYNLFREGTKSLREVLEMESAWRYLYGTGSVAGVYLPGS
RQTLTIYQALKKGLLSAEVARLLLEAQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDR
LLSAERAVTGYRDPYTEQPISLFQAMKKELIPAEEALRLLDAQLATGGIVDPRLGFHLPL
EVAYQRGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLKRCRRDDNSGQMLLPLSDA
RKLTFRGLRKQITVEELVRSQVMDEATALQLQEGLTSIEEVTKNLQKFLEGTSCIAGVFV
DATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEF
KDKLLSAERAVTGYKDPYSGKLISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHR
LPVEVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLP
LKEKKRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEE
ITISSSDGVVKSMIIDRRSGRQYDIDDAITKNLIDRSALDQYRAGTLSITEFADMLSGNA
GGFRSRSSSVGSSSSYPISSAVPRTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHR
NLVDNITGQRLLEAQACTGGIIDPSTGERFPVTEAVNKGLVDKIMVDRINLAQKAFCGFE
DPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDAR
TAQKLRDVSAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSV
SGSGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSGYGRRYASGPSASLG
GPESAVA
Download sequence
Identical sequences NP_071796.2.100692 NP_071796.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]