SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_076032.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_076032.2.92730
Domain Number 1 Region: 138-332
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.22e-59
Family BCR-homology GTPase activation domain (BH-domain) 0.00000000475
Further Details:      
 
Domain Number 2 Region: 68-132
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.64e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_076032.2.92730
Sequence length 332
Comment beta-chimaerin isoform 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MCSQELWLENERKCAMVRKSKPSRKRQELLAIAFGVKVGLKGGFLWSPLKLFACSQISSL
VRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC
SKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSG
FTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYSKFIEAA
KISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNLMNAENLGIVFGPTLM
RPPEDSTLTTLHDMRYQKLIVQILIENEDVLF
Download sequence
Identical sequences Q80XD1
NP_076032.2.92730 ENSMUSP00000066078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]