SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_078651.1.64365 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_078651.1.64365
Domain Number - Region: 35-118
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00706
Family BCR-homology GTPase activation domain (BH-domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_078651.1.64365
Sequence length 168
Comment hypothetical protein LCDV1gp026 [Lymphocystis disease virus 1]; AA=GCF_000839605.1; RF=na; TAX=36363; STAX=36363; NAME=Lymphocystis disease virus 1; AL=Complete Genome; RT=Major
Sequence
MFLGFIYYNQTIITLFVATPSVIKQLAFPPDLKLVHRYKFKTTTLFMVESNECTIECIRE
YDLNEFNPFQYNLQNIILQTSVVKIYLDNLDFFHRKNILFYLDVINGCSLKIILTVVYLL
TTFLLVCLCTFAMLNFYTYLYKKHNAAIPRDNIIILSDLPPNYQELQA
Download sequence
Identical sequences gi|13358470|ref|NP_078651.1| NP_078651.1.64365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]