SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_079538.3.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_079538.3.87134
Domain Number - Region: 60-141
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0557
Family Extracellular domain of cell surface receptors 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_079538.3.87134
Sequence length 150
Comment lymphocyte antigen 6 complex locus protein G5c precursor [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MRFMAGPAGSQSLGPLCFHSSPQALYTVLLIVLVMMSLVFGKFVPVNWEPPQPLPFPKYL
RCYRCLLETKELGCLLGSDICLTPAGSSCITLHKKNSSGSDVMVSDCRSKEQMSDCSNTR
TSPVSGFWIFSQYCFLDFCNDPQNRGLYTP
Download sequence
Identical sequences A0A1U9X7Y6 Q5SRR4
NP_079538.3.87134 NP_079538.3.92137 gi|262118212|ref|NP_079538.3| ENSP00000313380 ENSP00000372724 ENSP00000372917 ENSP00000391301 ENSP00000391878 ENSP00000413765 ENSP00000414953 ENSP00000313380 ENSP00000372724 ENSP00000372917 ENSP00000391301 ENSP00000391878 ENSP00000413765 ENSP00000414953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]