SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_080781.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_080781.1.92730
Domain Number 1 Region: 26-110
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000103
Family Extracellular domain of cell surface receptors 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_080781.1.92730
Sequence length 260
Comment BMP and activin membrane-bound inhibitor homolog precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MDRHSSYFFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQN
TNSPLTHGCLDSLASTADICRAKQAQNHSGPAMPTLECCHEDMCNYRGLHDVLSPSKSEA
SGQGNRYQHDSSRNLITKMQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSEN
KRLQDERQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGQENCCLTCDKMRQAELSNE
KILSLVHWGMYSGHGKLEFI
Download sequence
Identical sequences Q9D0L6
ENSMUSP00000025075 ENSMUSP00000025075 10090.ENSMUSP00000025075 ENSMUSP00000025075 NP_080781.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]