SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_084259.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_084259.1.92730
Domain Number 1 Region: 91-193
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-33
Family SH2 domain 0.0000425
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000276
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_084259.1.92730
Sequence length 259
Comment src-like-adapter 2 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MGSLSSRGKTSSPSPSSSGPDQEPVSMQPERHKVTAVALGSFPAGEQARLSLRLGEPLTI
ISEDGDWWTVQSEVSGREYHMPSVYVAKVAHGWLYEGLSREKAEELLLLPGNPGGAFLIR
ESQTRRGCYSLSVRLSRPASWDRIRHYRIQRLDNGWLYISPRLTFPSLHALVEHYSELAD
GICCPLREPCVLQKLGPLPGKDTPPPVTVPTSSLNWKKLDRSLLFLEAPASGEASLLSEG
LRESLSSYISLAEDPLDDA
Download sequence
Identical sequences Q8R4L0
ENSMUSP00000029164 ENSMUSP00000029164 10090.ENSMUSP00000105189 NP_084259.1.92730 XP_006500468.1.92730 ENSMUSP00000029164 ENSMUSP00000105189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]