SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_116116.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_116116.1.92137
Domain Number 1 Region: 324-402
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.53e-25
Family Intermediate filament protein, coiled coil region 0.0000415
Further Details:      
 
Domain Number 2 Region: 92-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000134
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 99-206
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000186
Family Myosin rod fragments 0.017
Further Details:      
 
Weak hits

Sequence:  NP_116116.1.92137
Domain Number - Region: 214-322
Classification Level Classification E-value
Superfamily Prefoldin 0.0199
Family Prefoldin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_116116.1.92137
Sequence length 499
Comment alpha-internexin [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSL
GLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNR
ALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRA
RCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLA
TLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR
STEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSIGQ
LENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPL
PNPSYLLPPRILSATTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVIS
TKKTEKSNIEETTISSQKI
Download sequence
Identical sequences Q16352
ENSP00000358865 ENSP00000358865 NP_116116.1.87134 NP_116116.1.92137 gi|14249342|ref|NP_116116.1| 9606.ENSP00000358865 ENSP00000358865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]