SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_177124.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_177124.1.80155
Domain Number 1 Region: 95-226
Classification Level Classification E-value
Superfamily TRAF domain-like 3.43e-26
Family MATH domain 0.002
Further Details:      
 
Domain Number 2 Region: 4-84
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000000018
Family MATH domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_177124.1.80155
Sequence length 231
Comment TRAF-like family protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MESTPPTEAFAELRFYVYNKKENKYFTIQDVEVKRFNALRMVWGLLKVLSYDTFTNPENG
FIFEGGECEFGVDVLVAPPLTNWEILSFDEKLSPPKFSWNLKNFSELKEDVYTSNKYPMG
GKEWVLKLYPKGNSRADGKYLSLYVHLADSETLKSDEKNFKQGHVRVLNPLGSNHVEVQS
SCWYKESSRGWGWDHFLSIANLRKTYLDKEDALNVEIEFKVVSATKYSPII
Download sequence
Identical sequences Q9FWZ4
AT1G69660.1 NP_177124.1.80155 3702.AT1G69660.1-P AT1G69660.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]