SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_177964.2.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_177964.2.80155
Domain Number - Region: 165-203
Classification Level Classification E-value
Superfamily Moesin tail domain 0.00432
Family Moesin tail domain 0.0083
Further Details:      
 
Domain Number - Region: 64-256
Classification Level Classification E-value
Superfamily Tropomyosin 0.0235
Family Tropomyosin 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_177964.2.80155
Sequence length 324
Comment ROP interactive partner 2 [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MPKPSIRGSELPQRQSPRLRTSLLSTSSDPHHLSRPITDRSPKLGLDRRSPRSGGPHTDP
LSQKKLGSRISGLESQLGQAQEELRLLKQQLAKAEAAKKRAQEELHRKKSKKPNTPAPER
DDIPGDGHQETDVFEVLDEKAKESEKTKNDELASKEDQINVLKARLYDLEKERVSLSEEN
ETLKDQLKKTDTEMSCAKAKEDEIASKVSQIGEELEESNETTAKLKKKLESVEEAKETLE
AEMKKLKVQTEQWRKAADAAAAVLSGGVEMNGRFSEQCGSMEKHFAGRFVGSPGMADDSD
DGSGKRKSSGKKMFGDLWKKKGQK
Download sequence
Identical sequences A0A178W8E0 Q9M9F9
AT1G78430.1 3702.AT1G78430.1-P NP_177964.2.80155 AT1G78430.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]