SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_228264.1.35502 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_228264.1.35502
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 6.74e-31
Family Ribosomal L11/L12e N-terminal domain 0.0000226
Further Details:      
 
Domain Number 2 Region: 67-140
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 8.05e-30
Family Ribosomal protein L11, C-terminal domain 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_228264.1.35502
Sequence length 141
Comment 50S ribosomal protein L11 [Thermotoga maritima MSB8]; AA=GCF_000008545.1; RF=reference genome; TAX=243274; STAX=2336; NAME=Thermotoga maritima MSB8; strain=MSB8; AL=Complete Genome; RT=Major
Sequence
MAKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITV
YEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANS
LEAAMKIIEGTAKSMGIEVVD
Download sequence
Identical sequences B1L939 G4FE16 P29395
2k3fA gi|15643220|ref|NP_228264.1| gi|170288282|ref|YP_001738520.1| gi|15643220|ref|NP_228264.1| 126740.TRQ2_0481 243274.TM0454 NP_228264.1.35502 WP_004081512.1.100023 WP_004081512.1.29620 WP_004081512.1.32102 WP_004081512.1.43545 WP_004081512.1.45724 WP_004081512.1.51363 WP_004081512.1.56403 WP_004081512.1.79805 282327 1mj1_L 1ml5_l 2jq7_A 2k3f_A 4v42_BL 4v4p_AL 4v4r_BK 4v4s_BK 4v4t_BK

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]