SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_493155.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_493155.1.50509
Domain Number 1 Region: 121-307
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.12e-18
Family Nuclear receptor ligand-binding domain 0.0096
Further Details:      
 
Domain Number 2 Region: 7-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-17
Family Nuclear receptor 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_493155.1.50509
Sequence length 310
Comment Nuclear hormone receptor family member nhr-89 [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MKIPEGPCRVCHSVKGTRRHFGITACMSCSSFFRRSLNCKFYCPANNSCTILDDQKQFCR
SCRYNKCVQSGMRRDCVRKQSYRRQAGRKEAKSPAVSCSNKLSESYEELLNFYVKEANES
IARKRQSPLKNAHQVKTSKELLEISKSEDKTSLDAVLHCYGTYILDDEDITTLIRYFKFM
NTWIDSAFVYSKSTSNEELLDGNDICKFAYQIDTSIGLSLKNLNLNIFEYAALRAICIWN
LKFYETSPKMKSLALEHYKGITGALRQYYENYMSDMDIAVRIGEITMQITTISDLFHDLI
TLHQKYQIPF
Download sequence
Identical sequences O02235
E03H4.13 6239.E03H4.13 E03H4.13 NP_493155.1.50509 E03H4.13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]