SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_505113.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_505113.1.50509
Domain Number 1 Region: 21-136
Classification Level Classification E-value
Superfamily TIMP-like 2.2e-22
Family Tissue inhibitor of metalloproteinases, TIMP 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_505113.1.50509
Sequence length 158
Comment Putative metalloproteinase inhibitor tag-225 [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MQNLSLSLVILSVLIAVTLACKCREQSTKESFCNAHWVSHVKVKVRVGKQGLPEGSERKG
LNNLRYTVQHVEVFKKPSNMTTLPDEIFTPSEAPACGLKIAAGHEYLLAGRVEGPNALYT
VLCGQVLPDDRSQTSFENVLEWKNVPQTLQSQVKSIKC
Download sequence
Identical sequences Q21265
K07C11.5 6239.K07C11.5 K07C11.5 K07C11.5 NP_505113.1.50509 G_YK7584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]