SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_573467.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_573467.2.92730
Domain Number 1 Region: 29-116
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.87e-28
Family SCAN domain 0.0005
Further Details:      
 
Domain Number 2 Region: 362-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.21e-21
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 326-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-16
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 4 Region: 404-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000164
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_573467.2.92730
Sequence length 468
Comment zinc finger and SCAN domain-containing protein 5B [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MATNVPPDSPVRSGQSVSLISQVKHGERQNYNPEFWHVKFRGFSPSEGSNWIQDLRSISE
LCYQWLRPDLNSKEEILDQLVLEQFLICMPPEQQALVKESGVKSCKDLEKLLRDRKRHNW
SIIYSQGQAHLLRHPSVGKAEAAEDKWGHTDFSQEHLSNESEESLNRGQASRELQNLSET
EEPSTSQEEGILLGVIPERRQPDYLRPEMSPGSDSVPDLEEAEASVFVGQDPLPALGPAG
SLGVKGAVQPQEDTVVDAVPSFTHILERDLALNRDLQSLSGFNLPTSQGVASYMGNTEDG
LEAANPEPANPQPEKQVDSLAGQARFQCTECKKSFLYKSRFDLHQRSHTGERPFKCILCN
KAFVQSSDLRVHQRVHTGEKPYMCEVCGMEFAHGSTLQGHSRVHTKEKPFVCKDCGQRFC
HKGNLNVHFRIHCNLRPYVCKKCNKTFRQQGTWKRHMKTHLRKRKVSE
Download sequence
Identical sequences B2RTN3
ENSMUSP00000072449 NP_573467.2.92730 XP_006539636.1.92730 ENSMUSP00000072449 10090.ENSMUSP00000072449 ENSMUSP00000072449 ENSMUSP00000126044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]