SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_636445.1.47755 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_636445.1.47755
Domain Number - Region: 26-86
Classification Level Classification E-value
Superfamily STAT 0.0726
Family STAT 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_636445.1.47755
Sequence length 98
Comment hypothetical protein XCC1070 [Xanthomonas campestris pv. campestris str. ATCC 33913]; AA=GCF_000007145.1; RF=reference genome; TAX=190485; STAX=339; NAME=Xanthomonas campestris pv. campestris str. ATCC 33913; strain=ATCC 33913; AL=Complete Genome; RT=Major
Sequence
MSDVVRDAQSHPGYYLPEHAQYRLQQLRDHMRFLARLAQPRTQAEEQARQPAIRLDELAC
CLELLAEQVTQALAQVQWPARLELDVSDNARADDGEAA
Download sequence
Identical sequences Q8PBP9
gi|21230528|ref|NP_636445.1| 190485.XCC1070 NP_636445.1.47755 WP_011036270.1.43481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]