SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_648646.2.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_648646.2.81976
Domain Number 1 Region: 186-246
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000000392
Family Tachycitin 0.01
Further Details:      
 
Domain Number 2 Region: 258-314
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000000144
Family Tachycitin 0.032
Further Details:      
 
Domain Number 3 Region: 135-188
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000235
Family Tachycitin 0.014
Further Details:      
 
Domain Number 4 Region: 54-128
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000418
Family Tachycitin 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_648646.2.81976
Sequence length 316
Comment uncharacterized protein Dmel_CG10154, isoform A [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MKWLLNGLLLLFIILMVHRNRADEDLVVAPGPDDDGEGLNVQDKDIYDMYENTQINVCGN
VADGVYLPYVGNCSKYIECENNTIKEVGSCLDLAKDNPDICDPNKSCELGYDPVLQVCTY
MEEVQCLPTCESFRLSSFCYDNTCTKYVLCYYGKPVLRQCHDGLQYNNATDRCDFPEYVD
CVANDCSATFQPEDIIYLGSKASCSKYYVCSNGHPWEQQCAPGLAYNPSCKCCDFAKNVN
CTIDAVARNILPYSRTPLRRADIKCPLMGTHFFPHKSRRDAYYYCVEGRGVTLDCTPGLY
YDPKVEDCRRPEFVGV
Download sequence
Identical sequences Q9VU72
NP_001189089.1.81976 NP_648646.2.81976 7227.FBpp0075589 FBpp0075589 FBpp0292212 FBpp0075589 FBpp0292212 FBpp0075589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]