SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_652616.1.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_652616.1.81976
Domain Number 1 Region: 51-248
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-47
Family SPRY domain 0.00037
Further Details:      
 
Weak hits

Sequence:  NP_652616.1.81976
Domain Number - Region: 238-273
Classification Level Classification E-value
Superfamily SOCS box-like 0.000288
Family SOCS box-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_652616.1.81976
Sequence length 293
Comment SP555, isoform B [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSDVEVDPQQAHPHPIAAIAPRRRRPTGRRGGVTGGLSSGSLDASSSTSPPPRFCPLPNG
VEDNWTWSKRHRSKEVVLRGPNSRTVHFHPNWSKGTAGVQGKRSLNNGRHYWELHVSQRV
FGTSIMFGIGTKSARLHANAFRNMLGENEHGWGLSHKGVLWHEGVALLYTKRFRENQPTQ
IGVLFDGIEGTLTFYKDGKCLGVAFRGLDQIDEPLYPIVCSTAAKTEMTLKCTRREFVNL
QDRCRAVIMRRVRSAAQLEKLKLPLPIADYLSEVIDEKKPLRQVDNYDILCDL
Download sequence
Identical sequences Q9V3U3
FBpp0078644 FBpp0305715 NP_001260074.1.81976 NP_652616.1.81976 FBpp0078644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]