SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_663583.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_663583.2.92730
Domain Number 1 Region: 87-382
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-75
Family Protein kinases, catalytic subunit 0.0000185
Further Details:      
 
Domain Number 2 Region: 28-104
Classification Level Classification E-value
Superfamily SH3-domain 4.81e-22
Family SH3-domain 0.00048
Further Details:      
 
Weak hits

Sequence:  NP_663583.2.92730
Domain Number - Region: 395-465
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0424
Family Regulator of G-protein signaling, RGS 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_663583.2.92730
Sequence length 1002
Comment mitogen-activated protein kinase kinase kinase 21 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MALPVAEGTADTPLSPARDDSGSTSSGMWAALYDYEARGEDELSLRRGQLVEVLSQDAAV
SGDEGWWAGQVQRRLGIFPASYVAPCGPVPPPAPPPPRPCSPVHVDFERLELKELIGAGG
FGQVYRATWQGQEVAVKAARRDPEQDAAAAAESVRREARLFAMLRHPNIIQLRGVCLRQP
HLCLVLEFARGGALNRALAAAASDPRAPGPRRARRIPPQVLVNWAVQIARGMLYLHEEAV
VPILHRDLKSSNILLLEKIEHDDICNKTLKITDFGLAREWHRTTRMSAAGTYAWMAPEVI
RSSLFSKGSDIWSYGVLLWELLTGEVPYRGIDGLAVAYGVAVNKLTLPIPSTCPEPFAKL
MKECWEQDPHIRPSFALILQQLTAIEEAVLTNMPQESFHSMQEDWKLEIQQMFSELRTKE
KELRSREEELSRAALQQKSQELLLRRREQQLAEREIDVLERELNVLIFQLSQEAPHVKKR
KGRFRRGRLRLKDGHRISLPSDFQHKITVQASPTLDKRRSSDSGLCSPPGSPLMLPRLRA
IQLTSDENNKTRGRNMVFRQEDFEDVKRSFKKKGCTWGPSSVQTKERPEGRERVRPLSDG
NSPWSSLLIKSQKTTPLASLFVDQPGSCEEQKLVPEGLEHRKPKQTKFPGQAHVGLPLCK
DSQREDSSEAESREEGSPKGSPVNNVGAPMLRKKTESALCECGMLLASMALGLDVRKLHG
AQAPAKPSPKMEKKEEGALQPASRCQSSPSSLLRQPSAGRAPSGGSTLLLPSAPSHSSKS
SLSMKCLLQAGKEESSLGNARDLCGPTTLTPDPGSAAPESGCELIPGLRPKTDYGVLRSM
PHAILEQTGERLPGCAIVGDKGCHHMQMGSEETPLWLQSAPEDSGLPHSPSPGPQRDLAS
QASLVKPEGVLGECQACPALPQRPHTASVRTTSPPTWVCDKDHQVPALACLLGAQERSRC
QTPSLLDASIEGQKKDCAMPLCRVKSVMCQPSIYALEKDFLT
Download sequence
Identical sequences Q8VDG6
ENSMUSP00000034316 ENSMUSP00000034316 NP_663583.2.92730 ENSMUSP00000034316 10090.ENSMUSP00000034316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]