SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_690865.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_690865.1.92137
Domain Number 1 Region: 5-87
Classification Level Classification E-value
Superfamily DEATH domain 1.79e-30
Family Pyrin domain, PYD 0.0000475
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_690865.1.92137
Sequence length 89
Comment pyrin domain-containing protein 1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MGTKREAILKVLENLTPEELKKFKMKLGTVPLREGFERIPRGALGQLDIVDLTDKLVASY
YEDYAAELVVAVLRDMRMLEEAARLQRAA
Download sequence
Identical sequences H2QB01 Q8WXC3
ENSP00000304336 HR2715 ENSPTRP00000013736 gi|23097246|ref|NP_690865.1| ENSPTRP00000013736 ENSP00000304336 NP_690865.1.87134 NP_690865.1.92137 XP_001158748.1.37143 XP_003807545.1.60992 2hm2_Q 000161266|e2hm2Q1|110.1.1.5|Q:1-89 cath|current|2hm2Q00/1-89 d2hm2q_ 9598.ENSPTRP00000013736 9606.ENSP00000304336 ENSP00000304336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]