SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_839860.1.101514 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_839860.1.101514
Domain Number - Region: 27-99
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.0207
Family Coiled-coil dimerization domain from cortexillin I 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_839860.1.101514
Sequence length 141
Comment LysB [Yersinia phage L-413C]; AA=GCF_000841405.1; RF=na; TAX=227940; STAX=227940; NAME=Yersinia phage L-413C; AL=Complete Genome; RT=Major
Sequence
MSKLMIVLVVLLSLAVSGLFLVKHKNASLRASLDRANNVASEQQTTITMLKNQLHVALTR
ADKNELAQVALRQELENAAKREAQREKTITRLLNENEDFRRWYGADLPDAVRRLHQRPAC
ADASDCPQRLPESESLPDAGQ
Download sequence
Identical sequences Q858W0 S1NU78
NP_839860.1.101514 WP_001540324.1.12050 WP_001540324.1.16798 WP_001540324.1.28568 WP_001540324.1.30232 WP_001540324.1.3912 WP_001540324.1.44051 WP_001540324.1.44855 WP_001540324.1.4541 WP_001540324.1.52271 WP_001540324.1.5546 WP_001540324.1.58097 WP_001540324.1.58617 WP_001540324.1.60544 WP_001540324.1.65456 WP_001540324.1.67029 WP_001540324.1.67590 WP_001540324.1.77455 WP_001540324.1.78956 WP_001540324.1.83936 WP_001540324.1.88686 WP_001540324.1.90842 WP_001540324.1.90960 WP_001540324.1.95784 gi|30065715|ref|NP_839860.1| Q858W0_9CAUD

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]