SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_869283.1.48053 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_869283.1.48053
Domain Number - Region: 16-72
Classification Level Classification E-value
Superfamily SRCR-like 0.0418
Family Scavenger receptor cysteine-rich (SRCR) domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_869283.1.48053
Sequence length 77
Comment hypothetical protein RB10168 [Rhodopirellula baltica SH 1]; AA=GCF_000196115.1; RF=reference genome; TAX=243090; STAX=265606; NAME=Rhodopirellula baltica SH 1; strain=1; AL=Complete Genome; RT=Major
Sequence
MAVTPFVKPTIDIPSLANATVFCSNIKYGRPTTLNTPSWVMIQTTKDDSVEISCWRSHSI
RRGPFISGCVCFGQSYC
Download sequence
Identical sequences Q7UFE2
243090.RB10168 gi|32476289|ref|NP_869283.1| NP_869283.1.48053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]