SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_872616.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_872616.1.100692
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.86e-44
Family G proteins 0.0000221
Further Details:      
 
Domain Number 2 Region: 189-228
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000785
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_872616.1.100692
Sequence length 281
Comment ras-related protein Rab-40C [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDG
RRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVP
RILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGM
EKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRS
YSLASGAGGSGSKGNSLKRSKSIRPPQSPPQNCSRSNCKIS
Download sequence
Identical sequences A0A1A6HY92 A0A287AY05 Q0PD11 Q6Y2E6 Q8VHQ4
NP_631893.1.92730 NP_872616.1.100692 NP_872616.1.4139 XP_004438292.1.5094 XP_005349122.1.66349 XP_006246043.2.100692 XP_006978888.1.50099 XP_015853055.1.50099 XP_015853056.1.50099 XP_020942568.1.46622 XP_020942569.1.46622 XP_021076666.1.100879 XP_021492875.1.76796 XP_021492876.1.76796 ENSMUSP00000026826 ENSMUSP00000026826 ENSMUSP00000127546 ENSMUSP00000136612 ENSRNOP00000027266 10090.ENSMUSP00000026826 10116.ENSRNOP00000027266 ENSMUSP00000026826 ENSRNOP00000027266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]