SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_926781.1.44878 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_926781.1.44878
Domain Number 1 Region: 18-101
Classification Level Classification E-value
Superfamily YggU-like 4.19e-27
Family YggU-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_926781.1.44878
Sequence length 111
Comment hypothetical protein glr3835 [Gloeobacter violaceus PCC 7421]; AA=GCF_000011385.1; RF=reference genome; TAX=251221; STAX=33072; NAME=Gloeobacter violaceus PCC 7421; strain=PCC 7421; AL=Complete Genome; RT=Major
Sequence
MRSPLPPMPDPEAFPPGAVSVDAGGITLTVWAQPRASCSEVVGWQQNAFKVRLAAPPVEG
KANAECVALIAAFFGVPRRQVSLVQGQQGRHKKIRIEAPADLLLVALQKLS
Download sequence
Identical sequences Q7NEP3
NP_926781.1.44878 gi|37523404|ref|NP_926781.1| 251221.glr3835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]