SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000017160.1.63113 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000017160.1.63113
Domain Number 1 Region: 15-73
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.000000000000255
Family YqbF N-terminal domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000017160.1.63113
Sequence length 136
Comment MULTISPECIES: hypothetical protein [Escherichia]; AA=GCF_000208485.1; RF=na; TAX=910237; STAX=910237; NAME=Escherichia sp. TW15838; strain=TW15838; AL=Contig; RT=Major
Sequence
MSGTSLNSQRLDTSRITCTAIIKCLRPVYRRAGIAFTRGENTVEVTEEQLAIIRADSVLS
VVSTTAAETLAEAGGLDVLGVGDLNARIRATVAGLDQANPEHFTAGGEPKVKAVSAVLGE
NVTAAQIKAALAEAQA
Download sequence
Identical sequences A0A1X3JSN6 B6HYK3
gi|209919774|ref|YP_002293858.1| 409438.ECSE_2583 WP_000017160.1.31878 WP_000017160.1.47647 WP_000017160.1.54918 WP_000017160.1.63113 WP_000017160.1.68632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]