SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000044485.1.81034 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000044485.1.81034
Domain Number 1 Region: 30-150
Classification Level Classification E-value
Superfamily PapD-like 4.11e-34
Family Pilus chaperone 0.00031
Further Details:      
 
Domain Number 2 Region: 144-236
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.00000000157
Family Periplasmic chaperone C-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000044485.1.81034
Sequence length 272
Comment molecular chaperone ClpE [Escherichia coli]; AA=GCF_001608245.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=STEC 3031; AL=Contig; RT=Major
Sequence
MSKRNAVTTFFTNRVTKALGMTLALMMTCQSAMASLAADQTRYIFLGDKDALTITVTNND
KERTFGGQAWVDNIVEKDTRPTFVVTPSFFRVKPNGQQTLRIIMASDHLPKDKESVYWLN
LQDIPPALEGSGIAVALRTKLKLFYRPKALLEGRKGAEEELSLQSRPDGRTMLVNTTPYI
FAIGSLLDGNGKKIATDNETAQKLLMFMPGDEVQVKGNVVKVASLNDYGELQTWTINQKK
TSASSGEKVSDSSVNLPDKADKADKADKADKK
Download sequence
Identical sequences A0A2K0PI36
WP_000044485.1.31379 WP_000044485.1.68697 WP_000044485.1.75679 WP_000044485.1.81034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]