SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000044494.1.63856 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000044494.1.63856
Domain Number 1 Region: 30-150
Classification Level Classification E-value
Superfamily PapD-like 5.23e-34
Family Pilus chaperone 0.00031
Further Details:      
 
Domain Number 2 Region: 144-235
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.0000000536
Family Periplasmic chaperone C-domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000044494.1.63856
Sequence length 263
Comment molecular chaperone ClpE [Escherichia coli]; AA=GCF_000351625.1; RF=na; TAX=1182673; STAX=562; NAME=Escherichia coli KTE66; strain=KTE66; AL=Scaffold; RT=Major
Sequence
MSKRNAVTTFFTNRVTKALGMTLALMMTCQSAVASLAADQTRYIFRGDKDALTITVTNND
KERTFGGQAWVDNIVEKDTRPTFVVTPSFFKVKPNGQQTLRIIMASDHLPKDKESVYWLN
LQDIPPALEGSGIAVALRTKLKLFYRPKALLEGRKGAEEGLSLQSRPDGRTMLVNTTPYI
FAIGSLLDGNGKKIATDNETAQKLLMFMPGDEVQVKGNVAKVDSLNDWGTLQVWTINQKK
TAAPSGQKASDSPVNPSDKADKK
Download sequence
Identical sequences L3NYR4
WP_000044494.1.39509 WP_000044494.1.63856 WP_000044494.1.85781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]