SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000062335.1.45089 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000062335.1.45089
Domain Number - Region: 3-63
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00667
Family Regulator of G-protein signaling, RGS 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000062335.1.45089
Sequence length 109
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_001584005.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=FSL W8-0050; AL=Contig; RT=Major
Sequence
MSMNHSDFFDFLQSKEVLPNNQELRQSFELIINGFIANEMPDLENIPLEHIDEFEKQFEQ
LRHYVTFYSDNSFRINGPDCELKEMLHLHLFTEQLEDVEKQGLEDEIFI
Download sequence
Identical sequences A0A0F5RIG2 A0A0U0GFK0 A0A150E2N5 A0A1K0AAA4 A0A229M366 A0A229MBV8 A0A2K1RRJ5 C2Z0K0 C2ZHG1 Q74P02
WP_000062335.1.101843 WP_000062335.1.13299 WP_000062335.1.16355 WP_000062335.1.20208 WP_000062335.1.20651 WP_000062335.1.23873 WP_000062335.1.26847 WP_000062335.1.31685 WP_000062335.1.35255 WP_000062335.1.39001 WP_000062335.1.39538 WP_000062335.1.40430 WP_000062335.1.43533 WP_000062335.1.45089 WP_000062335.1.46244 WP_000062335.1.46524 WP_000062335.1.55116 WP_000062335.1.59052 WP_000062335.1.64666 WP_000062335.1.67001 WP_000062335.1.69323 WP_000062335.1.73952 WP_000062335.1.782 WP_000062335.1.80649 WP_000062335.1.84422 WP_000062335.1.97262 WP_000062335.1.97842 gi|44004431|ref|NP_982099.1| 222523.BCE_A0092 gi|44004431|ref|NP_982099.1|NC_005707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]