SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000071474.1.97821 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000071474.1.97821
Domain Number - Region: 17-82
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0275
Family IP3 receptor type 1 binding core, domain 2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000071474.1.97821
Sequence length 122
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_000833655.1; RF=na; TAX=1441; STAX=1428; NAME=Bacillus thuringiensis serovar morrisoni; strain=HD 600; AL=Contig; RT=Major
Sequence
MSNSGADLSVSRLIVANVEEKEYHFIVREHPIVGKVISLFENGKEYGLLDKQIANKDKFI
TSELTKLDYFNLDVLYHTPGWIWIGMDQFGLHAREATYNEVDVIMKLKEDLYYIDIYEEI
KM
Download sequence
Identical sequences A0A0Q1AD06 A0A0Q9GP50 A0A0Q9H3E0 A0A160LB03 A0A242Y744 A0A243ALS7 A0A243M2V5 A0A2B9ER92 A0A2H3QW20 B7IKN4 C3DL21 J3ZW08 J7W5N3 J8G0Y4 Q3EV44 R8C9R7 R8INM4 R8RZ73 R8Z277
WP_000071474.1.100497 WP_000071474.1.101838 WP_000071474.1.12935 WP_000071474.1.13269 WP_000071474.1.22084 WP_000071474.1.26459 WP_000071474.1.27446 WP_000071474.1.28599 WP_000071474.1.34537 WP_000071474.1.3546 WP_000071474.1.35769 WP_000071474.1.36279 WP_000071474.1.38325 WP_000071474.1.4355 WP_000071474.1.48759 WP_000071474.1.50042 WP_000071474.1.52284 WP_000071474.1.58712 WP_000071474.1.59384 WP_000071474.1.60526 WP_000071474.1.61799 WP_000071474.1.6241 WP_000071474.1.64421 WP_000071474.1.70667 WP_000071474.1.73638 WP_000071474.1.83666 WP_000071474.1.87649 WP_000071474.1.87705 WP_000071474.1.89145 WP_000071474.1.92555 WP_000071474.1.9703 WP_000071474.1.97821 WP_000071474.1.97830 WP_000071474.1.98315 gi|434375868|ref|YP_006610512.1| gi|402559784|ref|YP_006602508.1| gi|218897968|ref|YP_002446379.1| 405531.BCG9842_B2338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]