SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000073388.1.14179 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000073388.1.14179
Domain Number - Region: 37-76
Classification Level Classification E-value
Superfamily YggU-like 0.0262
Family YggU-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000073388.1.14179
Sequence length 125
Comment hypothetical protein [Vibrio cholerae]; AA=GCF_001251495.1; RF=na; TAX=666; STAX=666; NAME=Vibrio cholerae; strain=GP16; AL=Scaffold; RT=Major
Sequence
MSNVYPVYKSNDNIKASLDNHLDTLLEAAKGSNKALGRINKAYDGIMLQLIKACKGEIEL
TKGQSDAIKIVLNEQKHLSKVVADLEELLKKVQAVEAVEGGQQPTTTPNTPPKPFDPRQF
KSTKF
Download sequence
Identical sequences A0A0H3ACZ2 A0A0H6FD21
gi|147671593|ref|YP_001215606.1| gi|147671593|ref|YP_001215606.1| 345073.VC0395_0770 WP_000073388.1.14179 WP_000073388.1.15134 WP_000073388.1.17738 WP_000073388.1.19428 WP_000073388.1.2316 WP_000073388.1.25649 WP_000073388.1.26223 WP_000073388.1.36322 WP_000073388.1.40782 WP_000073388.1.46540 WP_000073388.1.47794 WP_000073388.1.52676 WP_000073388.1.53085 WP_000073388.1.65528 WP_000073388.1.70775 WP_000073388.1.78428 WP_000073388.1.89719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]