SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000110286.1.54116 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000110286.1.54116
Domain Number - Region: 116-141
Classification Level Classification E-value
Superfamily Proline/betaine transporter ProP, C-terminal cytoplasmic domain 0.0392
Family Proline/betaine transporter ProP, C-terminal cytoplasmic domain 0.0077
Further Details:      
 
Domain Number - Region: 2-47
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 0.0798
Family Kix domain of CBP (creb binding protein) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000110286.1.54116
Sequence length 221
Comment MULTISPECIES: phage shock protein A [Bacillus cereus group]; AA=GCF_000290775.1; RF=na; TAX=1053239; STAX=1396; NAME=Bacillus cereus VD156; strain=VD156; AL=Scaffold; RT=Major
Sequence
MSVFKRLRDLTMSNVYSLIEKAEDPVKMTDQYLRDMQADVQEAEKSVAAQIALEKKFKIL
FEEQEALVKKREEQAHMAVQASNLDLARRALEEKQNAEQKMNEYKASYEQNKAAADNLRL
KLEEMRKQLNELKNKRETLVARVNAAKAQKNINQAMSGFDSNSAKAGLSRMEEKALQLEA
EAEASGEVYKKEKSLDDEFASLNKNSAVDDELARIMKQYEK
Download sequence
Identical sequences A0A0G8EQY6 A0A226R4R5 A0A2H2W2T0 C3H7U0 J8GU68 J8MKB1
WP_000110286.1.43434 WP_000110286.1.54116 WP_000110286.1.74337 WP_000110286.1.7544 WP_000110286.1.87873 WP_000110286.1.97327 WP_000110286.1.98053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]