SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000110292.1.2407 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000110292.1.2407
Domain Number - Region: 116-183
Classification Level Classification E-value
Superfamily Chorismate mutase II 0.0252
Family Dimeric chorismate mutase 0.045
Further Details:      
 
Domain Number - Region: 2-47
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 0.0811
Family Kix domain of CBP (creb binding protein) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000110292.1.2407
Sequence length 221
Comment MULTISPECIES: phage shock protein A [Bacillus]; AA=GCF_900100415.1; RF=na; TAX=1761770; STAX=1761770; NAME=Bacillus sp. yr331; strain=YR331; AL=Scaffold; RT=Major
Sequence
MSVFKRLRDLTMSNVYSLIEKAEDPVKMTDQYLRDMQADVQEAEKSVAAQIALEKKFKLL
FEEQEALVKKREDQAHMAVQASNLDLARRALEEKQNAEQKMNEYKASYEQNKAAADNLRA
KLEEMRKQLTELKNKRETLVARVNAAKAQKNINQAMSGFDSNSAKAGLSRMEEKALQLEA
EAEASGEVYKKEKSLDDEFASLNKNSAVDDELARIMKQYEK
Download sequence
Identical sequences A0A1D3PPP0 A0A1V6LIX7 A0A2C9YFD1 C2V245 C2VIG7 K0FU39 R8LF17
WP_000110292.1.100771 WP_000110292.1.11380 WP_000110292.1.13113 WP_000110292.1.14084 WP_000110292.1.2407 WP_000110292.1.24969 WP_000110292.1.24992 WP_000110292.1.30144 WP_000110292.1.37661 WP_000110292.1.42182 WP_000110292.1.42941 WP_000110292.1.4453 WP_000110292.1.46586 WP_000110292.1.474 WP_000110292.1.52532 WP_000110292.1.55893 WP_000110292.1.64770 WP_000110292.1.66535 WP_000110292.1.70209 WP_000110292.1.75358 WP_000110292.1.75374 WP_000110292.1.77968 WP_000110292.1.84323 WP_000110292.1.86041 WP_000110292.1.89698 WP_000110292.1.94270 gi|557621605|ref|YP_008782736.1| gi|407707327|ref|YP_006830912.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]