SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000215741.1.59384 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000215741.1.59384
Domain Number - Region: 40-82
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 0.000746
Family Domain of poly(ADP-ribose) polymerase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000215741.1.59384
Sequence length 145
Comment hypothetical protein [Bacillus cereus]; AA=GCF_000290955.1; RF=na; TAX=718223; STAX=1396; NAME=Bacillus cereus VD022; strain=VD022; AL=Scaffold; RT=Major
Sequence
MTVGFGVDCIFYEVGHPDLLHSFFSTMSYHAEPEGWGTKYPLLMKDLYFDKLSWDNVKEA
RENLKEIQNILQKKKPDEVVWDIEDLTKRPPWNGQPLPPQVINLATYYATPRGVTYFDLL
FHALDDAQEVEIDVVIRKSITDKTS
Download sequence
Identical sequences J7W0N6 R8XE08
WP_000215741.1.34537 WP_000215741.1.59384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]