SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000278299.1.46136 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000278299.1.46136
Domain Number - Region: 46-85
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0405
Family Integrin beta tail domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000278299.1.46136
Sequence length 146
Comment hypothetical protein [Staphylococcus aureus]; AA=GCF_001227145.1; RF=na; TAX=1280; STAX=1280; NAME=Staphylococcus aureus; strain=05-01089; AL=Scaffold; RT=Major
Sequence
MYKSKILLKYIFSEELDVKDLTEEKYNQDYEALTFSFKEETYQSRLAKKTPTKAGYFVAC
WTKDENNCNQPYSKEAFADYLMIIVIDEELSGYFLFPRELLVEKGILTTFEHKGKMAFRV
YPKWCNQLNKTAGQTQKWQCKYFFEY
Download sequence
Identical sequences WP_000278299.1.101645 WP_000278299.1.11312 WP_000278299.1.11969 WP_000278299.1.19497 WP_000278299.1.20906 WP_000278299.1.23476 WP_000278299.1.26225 WP_000278299.1.26424 WP_000278299.1.26947 WP_000278299.1.27303 WP_000278299.1.27720 WP_000278299.1.28107 WP_000278299.1.3219 WP_000278299.1.37536 WP_000278299.1.38311 WP_000278299.1.42336 WP_000278299.1.44853 WP_000278299.1.45747 WP_000278299.1.46136 WP_000278299.1.46837 WP_000278299.1.47792 WP_000278299.1.49757 WP_000278299.1.57944 WP_000278299.1.64334 WP_000278299.1.65082 WP_000278299.1.65125 WP_000278299.1.69559 WP_000278299.1.7089 WP_000278299.1.72112 WP_000278299.1.72965 WP_000278299.1.74899 WP_000278299.1.75680 WP_000278299.1.77013 WP_000278299.1.79037 WP_000278299.1.79334 WP_000278299.1.80318 WP_000278299.1.87943 WP_000278299.1.88395 WP_000278299.1.89715 WP_000278299.1.91310 WP_000278299.1.97077 WP_000278299.1.97293 WP_000278299.1.97311 WP_000278299.1.99963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]