SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000286356.1.98519 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000286356.1.98519
Domain Number - Region: 31-72
Classification Level Classification E-value
Superfamily Dimerization motif of sir4 0.0209
Family Dimerization motif of sir4 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000286356.1.98519
Sequence length 97
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_002148025.1; RF=na; TAX=180856; STAX=1428; NAME=[Bacillus thuringiensis] serovar konkukian; strain=BGSC 4AH1; AL=Scaffold; RT=Major
Sequence
MYRTTIDGKEIIITLAPKIRKEIIDRNPLYEAVFHNAARLLQTKQPTFAVNHEIFGLIIG
EVQRGEVTVFAVEHIIPKQNIFGPNNFFSTIEQQANL
Download sequence
Identical sequences A0A150DF78 A0A1H6BF93 A0A243EF49 A0A243IX72 A0A2C1ITW3
WP_000286356.1.101720 WP_000286356.1.37626 WP_000286356.1.4447 WP_000286356.1.61820 WP_000286356.1.61919 WP_000286356.1.89325 WP_000286356.1.98519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]