SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000286358.1.24792 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000286358.1.24792
Domain Number - Region: 31-72
Classification Level Classification E-value
Superfamily Dimerization motif of sir4 0.0432
Family Dimerization motif of sir4 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000286358.1.24792
Sequence length 97
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_000291095.1; RF=na; TAX=1053210; STAX=1396; NAME=Bacillus cereus HuB4-10; strain=HuB4-10; AL=Scaffold; RT=Major
Sequence
MYRTTIDGKEIIITLAPKIRKEITDRDPLYEAVFNTAARLLQTKQPTFAVNHEVFGLIIG
EVQRGEVTVFAVEHIIPKQNIFGTNNFFSTIEQRANL
Download sequence
Identical sequences A0A0M0MDA5 A0A1D3PF66 A0A1V6LIC7 A0A242WNM4 C2UTB8 C2V9R7 K0FJT9 R8M0B0
gi|407704087|ref|YP_006827672.1| gi|557623665|ref|YP_008784797.1| WP_000286358.1.100771 WP_000286358.1.11380 WP_000286358.1.13113 WP_000286358.1.14084 WP_000286358.1.2407 WP_000286358.1.24792 WP_000286358.1.24969 WP_000286358.1.24992 WP_000286358.1.30144 WP_000286358.1.3196 WP_000286358.1.37661 WP_000286358.1.42182 WP_000286358.1.42941 WP_000286358.1.4453 WP_000286358.1.46586 WP_000286358.1.474 WP_000286358.1.499 WP_000286358.1.52532 WP_000286358.1.54419 WP_000286358.1.55893 WP_000286358.1.5841 WP_000286358.1.64770 WP_000286358.1.66535 WP_000286358.1.70209 WP_000286358.1.75358 WP_000286358.1.75374 WP_000286358.1.77968 WP_000286358.1.84323 WP_000286358.1.86041 WP_000286358.1.89698 WP_000286358.1.94270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]