SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000291907.1.79549 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000291907.1.79549
Domain Number 1 Region: 1-48
Classification Level Classification E-value
Superfamily PriA/YqbF domain 6.41e-20
Family YqbF N-terminal domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000291907.1.79549
Sequence length 50
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_000399005.1; RF=na; TAX=1053170; STAX=1396; NAME=Bacillus cereus BAG1X1-1; strain=BAG1X1-1; AL=Scaffold; RT=Major
Sequence
MYYVKLIKGQSFYAFDHRFLVSEEEKVSEKIYNYLRRNEFFEVRKEEYSA
Download sequence
Identical sequences A0A0F6J4D8 A0A1B1L700 A0A1C9BUX3 A0A1D3NG49 A0A243AF86 A0A243EWT4 A0A2A2P6P7 M1PLN3 R8DVP2 R8FLB3 R8FV49 R8GH95 R8K8N5
WP_000291907.1.11442 WP_000291907.1.13279 WP_000291907.1.13975 WP_000291907.1.22152 WP_000291907.1.23245 WP_000291907.1.23297 WP_000291907.1.23360 WP_000291907.1.33790 WP_000291907.1.34125 WP_000291907.1.41090 WP_000291907.1.41729 WP_000291907.1.54547 WP_000291907.1.57561 WP_000291907.1.5895 WP_000291907.1.60255 WP_000291907.1.62277 WP_000291907.1.70108 WP_000291907.1.71652 WP_000291907.1.74651 WP_000291907.1.7534 WP_000291907.1.75891 WP_000291907.1.79549 WP_000291907.1.80622 WP_000291907.1.84541 WP_000291907.1.84775 WP_000291907.1.85667 WP_000291907.1.8577 WP_000291907.1.8907 WP_000291907.1.91020 WP_000291907.1.93838 WP_000291907.1.94914 WP_000291907.1.9533 WP_000291907.1.9700 WP_000291907.1.97816 gi|452199315|ref|YP_007479396.1| gi|384186956|ref|YP_005572852.1| gi|410675262|ref|YP_006927633.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]