SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000353836.1.14661 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000353836.1.14661
Domain Number - Region: 45-136
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.0667
Family Oxygen-evolving enhancer protein 3, 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000353836.1.14661
Sequence length 153
Comment MULTISPECIES: hypothetical protein [Enterobacteriaceae]; AA=GCF_000700385.1; RF=na; TAX=1444193; STAX=562; NAME=Escherichia coli 3-105-05_S3_C3; strain=3-105-05_S3_C3; AL=Contig; RT=Major
Sequence
MDILTWPLSQTVTDISSLAGIVGFVVTVKLFFTTRSLKATLRNKVRIPEIHSNLQKKASL
INDAIGDWVTQKEFIRKEFTECAVLTESLFSRLPTKERSKIDIFFDEVKPKGIFRRKEIS
ININDQDQAWKLYEKLSILNSRVNEIVKDMQLD
Download sequence
Identical sequences A0A228UN72
WP_000353836.1.10067 WP_000353836.1.14661 WP_000353836.1.16111 WP_000353836.1.18133 WP_000353836.1.25085 WP_000353836.1.27401 WP_000353836.1.32037 WP_000353836.1.33244 WP_000353836.1.42918 WP_000353836.1.47349 WP_000353836.1.58248 WP_000353836.1.59855 WP_000353836.1.62102 WP_000353836.1.64749 WP_000353836.1.65306 WP_000353836.1.7883 WP_000353836.1.79930 WP_000353836.1.80426 WP_000353836.1.90358 WP_000353836.1.93309 WP_000353836.1.97011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]