SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000358982.1.12434 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000358982.1.12434
Domain Number 1 Region: 5-100
Classification Level Classification E-value
Superfamily N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.00000000000000262
Family N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.0096
Further Details:      
 
Weak hits

Sequence:  WP_000358982.1.12434
Domain Number - Region: 110-176
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.0824
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000358982.1.12434
Sequence length 178
Comment F0F1 ATP synthase subunit delta [Streptococcus oralis]; AA=GCF_001071715.1; RF=na; TAX=1303; STAX=1303; NAME=Streptococcus oralis; strain=201_SPSE; AL=Scaffold; RT=Major
Sequence
MDKKTAKVIEKYSMPFVQLVIEKGEEDRIFSDLDQIKQVAEETGLPSFLAQVAVDESDKE
KTVGFFQDSVSPLMQNFIQVLIYNHRANLFYDIIVDCLNRLERETNQFIVTISSAHPLTD
EQKERLLPLIEKKMSLKVRSIKEQIDEGLIGGFVIFANHKTIDVSIKQQLRVVKENLK
Download sequence
Identical sequences A0A0F2DMR3 D4FSK1 E6KL92 I0QDH3
WP_000358982.1.11952 WP_000358982.1.12434 WP_000358982.1.15677 WP_000358982.1.16934 WP_000358982.1.19432 WP_000358982.1.39110 WP_000358982.1.50221 WP_000358982.1.53598 WP_000358982.1.64655 WP_000358982.1.8000 WP_000358982.1.97435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]