SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000366101.1.52676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000366101.1.52676
Domain Number - Region: 20-58
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00536
Family Mitotic arrest deficient-like 1, Mad1 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000366101.1.52676
Sequence length 66
Comment hypothetical protein [Vibrio cholerae]; AA=GCF_000021625.1; RF=na; TAX=345073; STAX=666; NAME=Vibrio cholerae O395; strain=O395; AL=Complete Genome; RT=Major
Sequence
MDLSNVRNFDSVILLGIVNEKLRLECDSLDELISTYEMDIEHLVGKLDVLGYQYDPLTNQ
FKAYAR
Download sequence
Identical sequences A0A085PEA3 A0A2J9UA44
gi|360035599|ref|YP_004937362.1| gi|384424758|ref|YP_005634116.1| WP_000366101.1.10887 WP_000366101.1.18375 WP_000366101.1.20065 WP_000366101.1.20595 WP_000366101.1.21671 WP_000366101.1.23134 WP_000366101.1.26813 WP_000366101.1.27435 WP_000366101.1.33625 WP_000366101.1.33819 WP_000366101.1.40782 WP_000366101.1.43428 WP_000366101.1.47736 WP_000366101.1.52676 WP_000366101.1.55208 WP_000366101.1.57098 WP_000366101.1.60216 WP_000366101.1.70069 WP_000366101.1.75796 WP_000366101.1.82193 WP_000366101.1.83761 WP_000366101.1.85086 WP_000366101.1.85388 WP_000366101.1.86874 WP_000366101.1.87301 WP_000366101.1.89447 WP_000366101.1.91247 WP_000366101.1.94255 WP_000366101.1.99992 gi|379741552|ref|YP_005333521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]