SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000366103.1.2496 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000366103.1.2496
Domain Number - Region: 20-58
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00523
Family Mitotic arrest deficient-like 1, Mad1 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000366103.1.2496
Sequence length 66
Comment MULTISPECIES: hypothetical protein [Vibrio]; AA=GCF_001402255.1; RF=na; TAX=666; STAX=666; NAME=Vibrio cholerae; strain=YB4G06; AL=Scaffold; RT=Major
Sequence
MDLSNVRNIDSVILLGIVNEKLRLECDSLDELISTYEMDIEHLVGKLDVLGYQYDPLTNQ
FKAYAR
Download sequence
Identical sequences A0A067B9L4 A0A220THP6
WP_000366103.1.1219 WP_000366103.1.24952 WP_000366103.1.2496 WP_000366103.1.25200 WP_000366103.1.35008 WP_000366103.1.4701 WP_000366103.1.61624 WP_000366103.1.68863 WP_000366103.1.74851 WP_000366103.1.87753 WP_000366103.1.90120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]