SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000386258.1.65577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000386258.1.65577
Domain Number - Region: 155-181
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000154
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.022
Further Details:      
 
Domain Number - Region: 26-65
Classification Level Classification E-value
Superfamily PH domain-like 0.00264
Family BPHL domain 0.024
Further Details:      
 
Domain Number - Region: 55-104
Classification Level Classification E-value
Superfamily DNA-binding C-terminal domain of the transcription factor MotA 0.00392
Family DNA-binding C-terminal domain of the transcription factor MotA 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000386258.1.65577
Sequence length 185
Comment MULTISPECIES: hypothetical protein [Streptococcus]; AA=GCF_001153425.1; RF=na; TAX=1313; STAX=1313; NAME=Streptococcus pneumoniae; strain=35F; AL=Scaffold; RT=Major
Sequence
MDYQLLPHEYMVMNSDHVSFGKNGLSTDELILTNLHLIYIKKGLWGGKKDQVTIPINQIK
IFEGKPQVSVTKTNGVKRLEIYYNGGQAIFAFNNTKDTDKWARNIIKLISGDTSNFETLG
DSSLFGADVLAETFKDTFDTFKAGLGIKDAEPEKISTKCSFCGAPLSGQVKQTVRCAYCD
MEQSL
Download sequence
Identical sequences A0A0T7JUC9 A0A1S1CRT4 F9HK37
WP_000386258.1.16793 WP_000386258.1.16952 WP_000386258.1.16955 WP_000386258.1.17291 WP_000386258.1.18770 WP_000386258.1.20934 WP_000386258.1.26021 WP_000386258.1.33874 WP_000386258.1.34739 WP_000386258.1.35432 WP_000386258.1.36160 WP_000386258.1.39337 WP_000386258.1.39824 WP_000386258.1.39968 WP_000386258.1.40005 WP_000386258.1.43426 WP_000386258.1.43503 WP_000386258.1.46284 WP_000386258.1.56581 WP_000386258.1.60180 WP_000386258.1.60326 WP_000386258.1.63191 WP_000386258.1.65537 WP_000386258.1.65577 WP_000386258.1.69343 WP_000386258.1.75880 WP_000386258.1.80130 WP_000386258.1.88141 WP_000386258.1.89190 WP_000386258.1.97892 WP_000386258.1.98896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]