SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000401349.1.24377 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000401349.1.24377
Domain Number - Region: 2-61
Classification Level Classification E-value
Superfamily SP0561-like 0.00785
Family SP0561-like 0.018
Further Details:      
 
Domain Number - Region: 127-185
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0275
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000401349.1.24377
Sequence length 235
Comment iron-sulfur cluster repair di-iron protein [Bacillus cereus]; AA=GCF_000743195.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=F1-15; AL=Scaffold; RT=Major
Sequence
MEHTFTETSIVGEIVTQFPKASDLFKSYRIDFCCGGNKPLIDAIHERNLSATEVITELNT
LYHNTKRLNESEIDWKNASYRELIDYVIHKHHRYLNEELPQLSPYVTKVLRAHGANQPHL
AKIHKLFHELKMELEQHLIKEETEDFPLILEFEKNPTDENYAKLRKVVDELENEHNHAGN
IIKELRKVTHDFTPPEGACGTYRLVYNRIEALESDLFEHIHVENNILFPRAITRA
Download sequence
Identical sequences A0A0T8YDW0 A0A1Y6AV78 A0A229MU19 A0A243NH39 B7HPC2 C2S324
WP_000401349.1.100684 WP_000401349.1.10069 WP_000401349.1.101309 WP_000401349.1.12751 WP_000401349.1.13299 WP_000401349.1.17408 WP_000401349.1.18840 WP_000401349.1.24377 WP_000401349.1.27334 WP_000401349.1.31685 WP_000401349.1.32522 WP_000401349.1.33061 WP_000401349.1.43762 WP_000401349.1.46746 WP_000401349.1.46864 WP_000401349.1.47097 WP_000401349.1.48164 WP_000401349.1.48311 WP_000401349.1.48599 WP_000401349.1.51087 WP_000401349.1.52756 WP_000401349.1.55057 WP_000401349.1.6753 WP_000401349.1.72514 WP_000401349.1.77576 WP_000401349.1.79658 WP_000401349.1.82986 WP_000401349.1.8450 WP_000401349.1.8923 WP_000401349.1.91404 WP_000401349.1.91615 WP_000401349.1.99266 405534.BCAH187_A2294 gi|375284201|ref|YP_005104639.1| gi|217959695|ref|YP_002338247.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]