SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000401372.1.85592 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000401372.1.85592
Domain Number - Region: 2-60
Classification Level Classification E-value
Superfamily SP0561-like 0.017
Family SP0561-like 0.019
Further Details:      
 
Domain Number - Region: 127-185
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0667
Family Mitotic arrest deficient-like 1, Mad1 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000401372.1.85592
Sequence length 235
Comment MULTISPECIES: iron-sulfur cluster repair di-iron protein [Bacillus]; AA=GCF_002216125.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=M13; AL=Complete Genome; RT=Major
Sequence
MEHTFTETSIVGEIVTQFPKASNLFKSYRIDFCCGGNKPLIDAIHERNLSATEVLTELNT
LYHNTKRLNESEIDWKNASYRELIDYVINKHHRYLNEELPQLSPYVTKVLRVHGASQPHL
AQIHKLFHELKMELEQHLIKEETEDFPLILEFEQNPIDENYVKLRKIVDELENEHNHAGN
IIKELRKVTNDFTPPEGACGTYRLVYQRLEALESDLFKHIHLENNILFPRAITRA
Download sequence
Identical sequences A0A1M6JL11 A0A1Y6A9X7
WP_000401372.1.14176 WP_000401372.1.19438 WP_000401372.1.25599 WP_000401372.1.32927 WP_000401372.1.41464 WP_000401372.1.6304 WP_000401372.1.6846 WP_000401372.1.68562 WP_000401372.1.85592 WP_000401372.1.96437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]